Return-Path: <> Delivered-To: BouncesSpecial@timism.com Received: from ssl.timism.com by ssl.timism.com with LMTP id qJooF5Z892I8ewAABYlj3Q (envelope-from <>) for ; Sat, 13 Aug 2022 10:27:34 +0000 Return-path: <> Envelope-to: BouncesSpecial@timism.com Delivery-date: Sat, 13 Aug 2022 10:27:34 +0000 Received: from mta-out-svc-02.tim.it ([217.169.118.20]:32830) by ssl.timism.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.95) id 1oMoMi-0008Dl-JI for BouncesSpecial@timism.com; Sat, 13 Aug 2022 10:27:34 +0000 Received: from mta-04.mx.internal (10.62.170.75) by mta-out-svc-02.tim.it (5.8.810) id 62E80D5E01842C44 for BouncesSpecial@timism.com; Sat, 13 Aug 2022 12:02:38 +0200 To: BouncesSpecial@timism.com From: Mail Administrator Reply-To: Mail Administrator Subject: Mail System Error - Returned Mail with Subject: (ClimateHell) Hydrophilia(water-loving): The simple, molecular smoking gun of droughts, fires and floods. Date: Sat, 13 Aug 2022 12:02:38 +0200 Message-ID: <20220813100238.TEEK14389.mta-04.mx.internal@mta-04> MIME-Version: 1.0 Content-Type: multipart/report; report-type=delivery-status; Boundary="===========================_ _= 6242173(14389)1660384958" X-Spam-Status: No, score=-1.9 X-Spam-Score: -18 X-Spam-Bar: - X-Ham-Report: Spam detection software, running on the system "ssl.timism.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: This Message was undeliverable due to the following reason: The user(s) account is temporarily over quota. Content analysis details: (-1.9 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% [score: 0.0000] 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 KAM_DMARC_STATUS Test Rule for DKIM or SPF Failure with Strict Alignment -0.0 T_SCC_BODY_TEXT_LINE No description available. X-Spam-Flag: NO --===========================_ _= 6242173(14389)1660384958 Content-Type: text/plain This Message was undeliverable due to the following reason: The user(s) account is temporarily over quota. Please reply to if you feel this message to be in error. --===========================_ _= 6242173(14389)1660384958 Content-Type: message/delivery-status Reporting-MTA: dns; mta-04.mx.internal Arrival-Date: Sat, 13 Aug 2022 12:02:38 +0200 Received-From-MTA: dns; mta-in-01.tin.it (10.62.187.14) Final-Recipient: RFC822; Action: failed Status: 4.2.4 --===========================_ _= 6242173(14389)1660384958 Content-Type: message/rfc822 Received: from mta-in-01.tin.it ([10.62.187.14]) by mta-04.mx.internal with ESMTP id <20220813100238.TEEH14389.mta-04.mx.internal@mta-in-01.tin.it> for ; Sat, 13 Aug 2022 12:02:38 +0200 X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedvfedrvdegkedgvdegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvffgnffgvefqoffkvfetnffkteenuceurghilhhouhhtmecufedtudenucgohfhorhgsihguuggvnhfjughrucdlhedttddmnecujfgurhepvffugggtrhfohfeshhdttddtiedtnecuhfhrohhmpefvhhgvohhrhifqfhfgvhgvrhihthhhihhnghesvfhimhhishhmrdgtohhmnecukfhppeehvddrhedrudejhedrfedtnecuhfhorhgsihguuggvnhfjughrpefvufggtghroffhsehhtddttdeitddpvffugggtrhfohfeshhdttddtiedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepvggtvddqhedvqdehqddujeehqdeftddrtghomhhpuhhtvgdquddrrghmrgiiohhnrgifshdrtghomhdpihhnvghtpeehvddrhedrudejhedrfedtpdhmrghilhhfrhhomhepuehouhhntggvshfuphgvtghirghlsehtihhmihhsmhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehguggvlhiiohhtsehtihhnrdhithdprhgvvhfkrfepvggtvddqhedvqdehqddujeehqdeftddrtghomhhpuhhtvgdquddrrghmrgiiohhnrgifshdrtghomhdpughkihhmpehprghsshdpghgvohhiphepfgfupdhmthgrhhhoshhtpehrrgiiohhrqdhinhdqthhinhdqtddu X-RazorGate-Vade-Verdict: spam 500 X-RazorGate-Vade-Classification: spam X-Razorgate-greyfolder: enabled Received: from ec2-52-5-175-30.compute-1.amazonaws.com (52.5.175.30) by mta-in-01.tin.it (5.8.810) id 629DCC7309F69425 for gdelzot@tin.it; Sat, 13 Aug 2022 12:02:23 +0200 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=timism.org; s=default; h=Date:Message-Id:From:Reply-To:Content-type:MIME-Version:Subject: To:Sender:Cc:Content-Transfer-Encoding:Content-ID:Content-Description: Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID: In-Reply-To:References:List-Id:List-Help:List-Unsubscribe:List-Subscribe: List-Post:List-Owner:List-Archive; bh=HF53f+LIL5LLJ42pMspOUrLKDnHrtxnfXUQc5zs2Lu0=; b=FWqze8vQux/MewTSzs7yfTYfnf dC1QacSn9bkwxrqScvFtKOZr9SUFQx2RGT+YheBE8LyrR+D4n2ZwUj6Qyhhttas1L/dvWuMnkbqyM NBdr4EJzItygik2PaFkYEX2fGjdjrz3MURfetli0rX6DoSoStTBcKkutHo6qUqt82OmONZewFma1+ LjKwGDqs9qLN7aj//WQP/8BRKoLSvirUBXuYtpgJgo5UEp1pzJVmEXUGr7BVXZMtrrt2EhoEmb0RA ZEZJbN4tk+vcpCybm7TgnhmMGZXZ3fvSQRS1Pkqh6Sv72IN8aWlxn4A3iA/JZ5t6Y/x4vCVb32wGL Yf8+sNlw==; Received: from timismor by org.timism.com with local (Exim 4.95) (envelope-from ) id 1oMnyH-0007AC-QV for gdelzot@tin.it; Sat, 13 Aug 2022 10:02:21 +0000 To: gdelzot@tin.it Subject: (ClimateHell) Hydrophilia(water-loving): The simple, molecular smoking gun of droughts, fires and floods. X-PHP-Script: timism.org/MassMail/MassMailer.php for 73.147.155.27 X-PHP-Originating-Script: 1001:MassMailer.php MIME-Version: 1.0 Content-type: text/html;charset=UTF-8 Reply-To: Noreply@Timism.org X-Mailer: PHP/7.3.28 From: TheoryOfEverything@Timism.com Message-Id: Date: Sat, 13 Aug 2022 10:02:21 +0000 X-AntiAbuse: This header was added to track abuse, please include it with any abuse report X-AntiAbuse: Primary Hostname - org.timism.com X-AntiAbuse: Original Domain - tin.it X-AntiAbuse: Originator/Caller UID/GID - [1001 993] / [47 12] X-AntiAbuse: Sender Address Domain - timism.com X-Get-Message-Sender-Via: org.timism.com: authenticated_id: timismor/only user confirmed/virtual account not confirmed X-Authenticated-Sender: org.timism.com: timismor X-Source: X-Source-Args: /opt/cpanel/ea-php80/root/usr/bin/php-cgi X-Source-Dir: timism.org:/public_html/MassMail Hydrophilia: The simple, molecular smoking gun of droughts, fires and floods (mailer)

Media Critique: Pro or Con ... Please share with friends.

CO2's Hydrophilia(water-loving): The simple, molecular "smoking gun" of droughts, fires and floods.
  1. Molecularly, CO2 likes water more than water likes itself whence carbonated beverages having up to 27% CO2 of volume.
  2. Increased atmospheric carbonation soaks up more ground and atmospheric water (FRQs at 34:1) causing droughts and fires.
  3. Subsequently, downwind "soda bottle shakes" of the aggregated FRQ's into atmospheric rivers cause destructive deluges and floods.
  4. As transparent globular cluster of water, FRQs may act like a drop of water on a leaf which concentrates sunlight into a heat sufficient to burn the leaf. This possible phenomenon may explain the unprecedented 2022 heat waves.
If one doesn't understand electricity and chemistry, one is flying blind in understanding climate change. Documenting and projecting climate trends is not understanding climate change. Members of the American Meteorological Society are like the doctors who can predict your death, but because they don't understand the underlying cause they cannot diagnose the disease so as to stop your death. I do: Unique qualifications.

Historical events (Oil Droughts) buttressing the CO2 hydrophilia thesis: Important to note that each barrel of oil on the average has 140 barrels of natural gas whence blow-outs at oil wells. Most oil field natural gas has no commercial value since it cannot be profitably transported so it is burned off. Saudi Arabia daily burns about 7 billion cubic feet of natural gas.

  1. Horn of Africa: Downwind from Saudi/Kuwait/etc. oilfields, the drought began and grew in 1965. During the 9-month OPEC oil embargo of the mid-1970s when Saudi production dropped 95%, normal precipitation returned. Since then, the social, economic and political chaos has worsened.
  2. Brazil/Amazon Forest: Brazil developed massive oil wells off its east coast: 50,000>100,000 barrels per day. As the wells developed, burned-off natural gas metastasized a growing downwind drought envelope expanded in Amazon rain forest reversing its CO2 sequestering into CO2 generation.
  3. US Dustbowl #1: Began late 1920s with upwind massive East Texas oil fields burning off vast amounts of non-commercial natural gas. The CO2 traveled as Texas Panhandler across the Mid-West. Ended in 1939 with beginning of World War II when production dropped by 65%. Blaming the farmers was mis-placed blame.
  4. US Dustbowl #2: Began after WWII with development of West Texas Permian Basin. Ended in 1956 when cheap Arab oil flooded market causing massive drop in US production.
  5. Hurrican Katrina and subsequent East Coast creeping drought: Hurricane Katrina destroyed many Gulf of Mexico oil and gas pipelines from massive GOM wells (50,000>100,000 barrels perday). Repairing oil lines first and burning off (illegally) the natural gas, a drought envelope expanded up the US East Coast. (VaTech almost canceled 2nd semester do to lack of water from extended drought.)
  6. Afghanistan Chaos: Upwind Caspian Sea oil field burnoff reduces downwind Afghani precipitation by 85%, insufficient for wheat but enough for opium (the main revenue source for the Taliban).
    (Fifteen oil drought events are documented in Global Dying.)

While the burned-off natural gas can be curtailed, the following closed loop is probably unstoppable.

  1. Drought due to atmospheric CO2 soaking up water,
  2. Forest Fire (massive amounts of CO2 released from burning wood),
  3. More Droughts,
  4. More Forest Fires,
  5. ad infinitum.

Consistently, CO2's Hydrophilia has caused precipitation changes (too little or too much) leading to social, economic and political chaos grounded in universal, acclerating inflation from less food and more mouths, e.g., Syria is the midst of 900 year drought.

Additional ramifications are detailed in Carbon Dioxide--The Global, Multi-Tasking Killer Molecule.

Full essay uploaded to https://timism.com/GlobalDying/Media/2021/Hydrophilia_SmokingGun.htm and top right link at Timism.com.

--===========================_ _= 6242173(14389)1660384958--